General Information

  • ID:  hor002439
  • Uniprot ID:  P85527
  • Protein name:  Myosuppressin
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Myosuppressin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QDVDHVFLRF
  • Length:  10
  • Propeptide:  MAIFCNNVLAALPTQCNPGFLDDLPPRIRKVCVALSRIYELGSEMESYIGDKENHITGFHESIPLLDSGVKRQDVDHVFLRFGRRR
  • Signal peptide:  MAIFCNNVLAALPTQCNP
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit spontaneous contraction of muscles
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85527-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002439_AF2.pdbhor002439_ESM.pdb

Physical Information

Mass: 143615 Formula: C59H86N16O16
Absent amino acids: ACEGIKMNPSTWY Common amino acids: DFV
pI: 5.41 Basic residues: 2
Polar residues: 0 Hydrophobic residues: 5
Hydrophobicity: -4 Boman Index: -2360
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 97
Instability Index: 3249 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17068263
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera